PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_25027-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28553.3 Da    PI: 8.0454
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_25027-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.55.4e-26958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien+snrqvtf+kRr+g+ KKA E+ vLCdaev v+ifss gkly++ 
  TRIUR3_25027-P1  9 KRIENSSNRQVTFAKRRAGLVKKAREIGVLCDAEVGVVIFSSAGKLYDFW 58
                     79*********************************************995 PP

2K-box23.42.5e-0971107137
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRh 37 
                      yq++sgk l+++k++s + e++++kke++n+q e+R+
  TRIUR3_25027-P1  71 YQTNSGKILWDEKHKSISAEIDRVKKENDNMQIELRQ 107
                      79999999**************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.441161IPR002100Transcription factor, MADS-box
CDDcd002652.22E-39280No hitNo description
SuperFamilySSF554555.89E-31295IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-27323IPR002100Transcription factor, MADS-box
PfamPF003195.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT FAKRRAGLVK KAREIGVLCD AEVGVVIFSS AGKLYDFWTP  60
KTTLPRILEK YQTNSGKILW DEKHKSISAE IDRVKKENDN MQIELRQAYE RRGCELPAAQ  120
GTDRHRGSSH ERPDQPQGQD DGPLEDAQEE CMGPKFTTAL CISFCTPWEF LEEEFAKICF  180
LLAKKILIML LLCDLPQEKM LEEEHKLLAL RMSRINHPAE LQTCIIFCQL VKWSIIISSK  240
GIILVSVKCC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-18186178Myocyte-specific enhancer factor 2B
1tqe_Q7e-18186178Myocyte-specific enhancer factor 2B
1tqe_R7e-18186178Myocyte-specific enhancer factor 2B
1tqe_S7e-18186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3712860.0AK371286.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2129M01.
GenBankAM5028800.0AM502880.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM14 (WM14 gene).
GenBankAY5410660.0AY541066.1 Hordeum vulgare subsp. vulgare PISTILLATA-like protein mRNA, complete cds.
GenBankKU7403080.0KU740308.1 Hordeum vulgare PISTILLATA-like MADS-box transcription factor PI-1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8A0J50.0M8A0J5_TRIUA; MADS-box transcription factor 2
STRINGMLOC_44514.12e-71(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-44MIKC_MADS family protein